Web stats for Srtechs - srtechs.net
SR Tech Services is a company established in UAE providing installation, renovation and maintenance services on Elevators, Escalators, Central A/c and Automatic doors.
Traffic Report of Srtechs
| Daily Unique Visitors: | 269 |
| Daily Pageviews: | 538 |
Estimated Valuation
| Income Per Day: | $ 2.00 |
| Estimated Worth: | $ 480.00 |
Search Engine Indexes
| Google Indexed Pages: | Not Applicable |
| Yahoo Indexed Pages: | Not Applicable |
| Bing Indexed Pages: | Not Applicable |
Search Engine Backlinks
| Google Backlinks: | Not Applicable |
| Bing Backlinks: | Not Applicable |
| Alexa BackLinks: | Not Applicable |
Safety Information
| Google Safe Browsing: | No Risk Issues |
| Siteadvisor Rating: | Not Applicable |
| WOT Trustworthiness: | Not Applicable |
| WOT Privacy: | Not Applicable |
| WOT Child Safety: | Not Applicable |
Website Ranks & Scores
| Google Pagerank: | Not Applicable |
| Alexa Rank: | 1,787,503 |
| Domain Authority: | Not Applicable |
PageSpeed Score
Siteadvisor Rating
Not Applicable
Where is srtechs.net server located?
Hosted IP Address:
162.215.253.15
Hosted Country:
US
Location Latitude:
42.509Location Longitude:
-71.1984Social Engagement
| Facebook Shares: | Not Applicable |
| Facebook Likes: | Not Applicable |
| Facebook Comments: | Not Applicable |
| Twitter Count (Tweets): | Not Applicable |
| Linkedin Shares: | Not Applicable |
| Delicious Shares: | Not Applicable |
Page Resources Breakdown
Homepage Links Analysis
Website Inpage Analysis
| H1 Headings: | 3 | H2 Headings: | 5 |
| H3 Headings: | 14 | H4 Headings: | 12 |
| H5 Headings: | Not Applicable | H6 Headings: | Not Applicable |
| Total IFRAMEs: | Not Applicable | Total Images: | 14 |
| Google Adsense: | Not Applicable | Google Analytics: | Not Applicable |
Websites Hosted on Same IP (i.e. 162.215.253.15)
Home Page
We are custom manufacturers of metal products for industrial and private sector use. We have the ability to replicate OEM parts and design new machinery as well as provide on site repair and maintenance.
Not Applicable 
$ 8.95
Dharma Salon & Boutique | Salon de Belleza y Boutique en Cancun
DHARMA es reconocido por brindar los mejores manicures, pedicures y servicios de depilación. También nuestros servicios de estética, faciales y masajes son tratamientos que no solo transforman tu apariencia, sino también tu estado de ánimo. Nuestra intención es que te sientas relajada, hermosa y feliz todos los días…
Not Applicable $ 8.95
HTTP Header Analysis
Status-Code: 200
Status: 200 OK
Date: Fri, 05 Aug 2016 22:02:40 GMT
Server: Apache Phusion_Passenger/4.0.10 mod_bwlimited/1.4 mod_fcgid/2.3.9
Last-Modified: Thu, 28 Jul 2016 06:05:34 GMT
ETag: "1da00e3-6501-538abec07dace"
Accept-Ranges: bytes
Content-Length: 25857
Content-Type: text/html
Domain Information for srtechs.net
| Domain Registrar: |
EVOPLUS LTD
|
|---|---|
| Registration Date: | 2015-09-24 8 years 6 months 3 weeks ago |
| Last Modified: | 2016-03-10 8 years 1 month 1 week ago |
| Expiration Date: | 2017-09-24 6 years 6 months 2 weeks ago |
DNS Record Analysis
| Host | Type | TTL | Extra |
|---|---|---|---|
| srtechs.net | A | 14397 |
IP:162.215.253.15 |
| srtechs.net | NS | 38400 |
Target:fastinfo.mars.orderbox-dns.com |
| srtechs.net | NS | 38400 |
Target:fastinfo.mercury.orderbox-dns.com |
| srtechs.net | NS | 38400 |
Target:fastinfo.venus.orderbox-dns.com |
| srtechs.net | NS | 38400 |
Target:fastinfo.earth.orderbox-dns.com |
| srtechs.net | SOA | 7200 |
MNAME:fastinfo.mars.orderbox-dns.com RNAME:a2zaccts.gmail.com Serial:2016071702 Refresh:7200 Retry:7200 Expire:172800 |
| srtechs.net | MX | 38400 |
Priority:100 Target:us2.mx3.mailhostbox.com |
| srtechs.net | MX | 38400 |
Priority:100 Target:us2.mx2.mailhostbox.com |
| srtechs.net | MX | 38400 |
Priority:100 Target:us2.mx1.mailhostbox.com |
| srtechs.net | TXT | 38400 |
TXT:v=spf1 redirect=_spf.mailhostbox.com |
Similarly Ranked Websites to Srtechs
Homebrew Equipment Deals
Find the best home brewing supplies and the best gifts for beer lovers.
1,787,508 $ 480.00
WordPress.com — Buradan Ücretsiz bir Blog alın
- kocaelizmitsatilikarsadairevfiyatlari.wordpress.com
sahibinden satılık kocaeli izmit arsa, daire, konut, ev, villa, yat, tekne fiyatları başiskele, çayırova, darıca, derince, dilovası, gebze, gölcük, izmit, kandıra, karamürsel, kartepe, körfez bulabilirsiniz.
1,787,508 $ 480.00
Buy Handmade Shoes,Bags,Accessories Online for Men & Women | Kethini
Kethini,makers of hand made shoes,bags,accessories for men & women,aims to cater the young urban Indian consumer needs by offering the highest quality stuff with innovative material and fresh new designs.
1,787,508 $ 480.00
Fs Fashion Online Shop für sexy Mode, Dessous und Kleider
Online Shop für sexy Dessous und Kleidung. Unsere Dessous, Gogo Outfits, Accessoires, sexy Kleider vom feinsten. sexy Mode in Fashion Shop zu günstigen Preisen.
1,787,514 $ 480.00